DPCstruct | MC13046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 147 ± 21 aa |
| Standard deviation of domain lengths | 20.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A140KDW2 | 1-126 | MADFAEWVTAAEPALGFKSGTFLQAYQTNREQSQKLTIEDSPVALAIQSLLERESCWQGTATELLKLIKGYATKYEYSASDLPKAAN… |
| A0A1V6GG68 | 2-152 | LTREIEAARDAGLSWLCRVMARALADAGPVPKGMNRRHPDWAAWVWRLGRAAGMAEEAERAIRENESFKAVFAVSNDAFGRFLLAGV… |
| A0A6G3TRF0 | 341-493 | None |
| A0A7J3TAZ3 | 395-545 | None |
| R9IQY7 | 19-169 | None |
| G0JNI5 | 22-165 | None |
| A0A847SNH6 | 848-1042 | None |
| A0A7V9TQM1 | 1-135 | None |
| A0A369L4N2 | 240-364 | None |
| A0A7X7F7N1 | 29-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.