DPCstruct | MC13042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5KDQ3 | 2-94 | LLSPTEDEGALDWRERCRTRLRQRVRPVTDGMRVRFPEPIRFEDGHYATEFIVVKRGARITVRCASGFGHYRIRNFRDLPWTVVPVT… |
| A0A165TIM8 | 49-148 | PYLYDCPESILDLLTPTDDEATNMWRERCRSTAMKRASIRSLQDGAFIELSDPVLFTNGMRLVAFQVKKFGRKLRFMDPRDGWMYQI… |
| A0A2H5F5Y5 | 1-86 | None |
| A0A7X5Y1Y1 | 1-102 | None |
| G9R6R2 | 88-182 | None |
| A9EBN9 | 5-110 | None |
| A0A367ELH7 | 104-241 | None |
| A0A7W5X5I3 | 100-203 | None |
| A0A6N7JUV6 | 46-146 | None |
| A0A175XYV7 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.