DPCstruct | MC13040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0W3Q8 | 2-75 | SSRRMLYPYHIKAKFALFPHRFMWEKDWRFKYTCIAAILVLPIMLKLQSGINSPGNVKRWEATVAKNEAEHQKH |
| A0A835CS22 | 189-266 | DAPISKERNMKFPYTLTAKMVNFPYKHYYKHAWLTRYWIAGLIVCVPIFYKITQAVNSPENVEKWRKIREAEYAGTHH |
| A0A131YAI0 | 24-100 | None |
| A0A1W4X146 | 77-176 | None |
| A0A821SZ21 | 1-75 | None |
| A0A2R7W7U5 | 23-99 | None |
| A0A194PGE9 | 57-129 | None |
| A0A194RGS4 | 118-202 | None |
| T1JGE9 | 85-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.