DPCstruct | MC1304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3B6P4 | 74-203 | NKILELPHLIGYTLSKLRTYEWARYNMFAREDIYHHTPGFYFRFRNPGKLYNELATCIDAFHGELQWKLYLGLETRNQNYSLEPYEV… |
| A0A150AGX8 | 4-130 | NEVSTMIFEALEYLAPIKTPLVDMLSGKNIYGRPPFLRFRFDIPDENDELYIKVENIISNYHGKLKWILIRRKNNYFLMPFLLSKYI… |
| A0A4D4LUW5 | 1-101 | None |
| A0A1M7Z2F7 | 4-141 | None |
| A0A0P4R9K1 | 45-174 | None |
| A0A4R9ESG7 | 2-114 | None |
| A0A2M9K5R1 | 2-107 | None |
| A0A1M5MX88 | 1-138 | None |
| A0A2K4XS94 | 372-512 | None |
| A0A1I2I7W9 | 20-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.