DPCstruct | MC13036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0VU30 | 15-165 | TRSSGNCSNGNCDDSDDDEKCPPDSILDGDGTCRCEFRHCFQPICRAPAQSVLRKKSNSVPGDCCDVYECVSHDKNCSDVICPEEVE… |
| A0A0A9W3C1 | 202-317 | CGACGIPSPDGVTCVCDNGCCPLPPMCGPSQELVTVNKATKIYPMCCDTYACVGKILCPQDSVMGPNGDCICSPCPTPLCAPGTQIV… |
| A0A0S7GAY0 | 216-353 | None |
| E3LTL9 | 104-256 | None |
| A0A834KFD0 | 107-250 | None |
| A0A182EQ35 | 5-167 | None |
| A0A7R9AVM4 | 27-174 | None |
| S4RFK1 | 1-144 | None |
| A0A7R9IXR7 | 46-219 | None |
| A0A0S7GAF6 | 173-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.