DPCstruct | MC13034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 66.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H641 | 1-74 | MRECRTPKDWSLLALQNTRTGKSHYLVICKCPEHYKMEGPMAHDQPTYASVPGIRVFGMMCVKPGYPIRKPSYQ |
| E0VSE4 | 1-74 | MRICRAPRDWSLLALQNIRTGKSHYLVICRCPNKGRLEGPMSHDQPAYASVPGIRVYGMMCIRDSYRINRSFRY |
| J9KZA3 | 142-254 | None |
| A0A6V7H1I7 | 331-419 | None |
| A0A7R9L1D6 | 54-140 | None |
| A0A1D2NKP6 | 66-158 | None |
| A0A151I4D9 | 202-284 | None |
| A0A0L7QMU3 | 410-513 | None |
| A0A0C9QRX4 | 218-307 | None |
| E9HDK6 | 118-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.