DPCstruct | MC13033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7U4N9 | 31-200 | GEREKLLERQYTWRGNKLPPMNIEPFATDRLRMDGMTDADRALRRQWLADQKLAPNEPRFVPELFPRNPIRRIYAAPWNALFNALKP… |
| E0VQV2 | 6-168 | GPGVKAFSLQGRFHDVRRRVFMTDEERRWRAQFLKDIQLADGEPRYVPEYYRATTNPIRRLWKSPMWVLQNFLQSKLGETPGYHVRH… |
| A0A1B6GPX4 | 11-169 | None |
| A0A6P7TDY5 | 23-190 | None |
| A0A0D8XSP9 | 29-195 | None |
| A0A654I5N7 | 11-173 | None |
| A0A5N4AB77 | 5-167 | None |
| A0A6J8DJC8 | 1-187 | None |
| A0A419QHL1 | 142-333 | None |
| A0A2G9U119 | 7-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.