DPCstruct | MC13032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 30.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7HZ22 | 25-120 | KLNDPRLVYTGFLGYCAGLLNNALKGRPVLKAGLHRQLLYVTSFYFVGYFFLKRQEYWYAVRDHDMFGYMKLHPEDFPEKEKKTYGE… |
| E0VP40 | 41-138 | YSWKDKNFFPVSMGALGITVPIVYNYLLRRPLWSGVPLYFLSIGGFYFFAKQWNTYRLGALMEKEAIYKHYISLHPEDFPPFEKTQI… |
| A0A4W2GFT6 | 16-120 | None |
| A0A673KFB8 | 6-110 | None |
| A0A7I8VV57 | 1-99 | None |
| M7BK75 | 2-75 | None |
| A0A6A4V888 | 20-120 | None |
| T1FG28 | 9-106 | None |
| A0A813M7F0 | 62-163 | None |
| A0A1D2N0K4 | 26-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.