DPCstruct | MC13029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Standard deviation of domain lengths | 15.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1VNU7 | 81-238 | KLSTFRITLIIQSLLLILDVLFTLSVDFIRNIYIIVVIIYFCQFFCILWNVMMFTITLVSTNAFKAGYYNLLLNDFGYVFIITFLYF… |
| E0VIA7 | 1-161 | MSYSVRYTFLLTTQILLIIADVLLNSLSEFTRLKPELQLVAFIFQDVFIVISLTVTLIGFFSTYVFQAGLVELLFDRFRLAILISVF… |
| A0A7S4E2F6 | 18-185 | None |
| A0A7R8WD55 | 823-960 | None |
| A0A044R8K4 | 2-156 | None |
| A0A2Y9ENU6 | 3-159 | None |
| A0A6L2Q8E4 | 2-191 | None |
| A0A819W137 | 5-162 | None |
| A0A803VAJ2 | 1-126 | None |
| A0A835ZR89 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.