DPCstruct | MC13027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 95.28 |
| Assigned Pfam label(s) | CL0005- CL0547- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0VFS0 | 8-104 | TVLTVLCFTSTIVVSFSCVCSPSECEDISKDDCPGGGTVWDPCRCCRVCARIEGEACGGPHGFYGTCADGLDCIVASHASGKPVLAA… |
| A0A444U267 | 163-232 | QFCHWPCKCSIKPLCAPGVSLVKDGCGCCKMCAKQVGEICNEAEVCDPHKGMYCDYSTDRPRFEVGVCAY |
| A0A7M5WZV1 | 2-106 | None |
| A0A7N8YA34 | 24-115 | None |
| A0A1D2N2M8 | 48-133 | None |
| A0A7G7P0F2 | 11-128 | None |
| C3ZHH1 | 1-134 | None |
| A0A6P8HVB2 | 15-92 | None |
| A0A5A9NDL5 | 15-88 | None |
| B7PQV9 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.