DPCstruct | MC13026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 210 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 70.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0VCK9 | 1-178 | MAAVEAIHRAVEFNPHVPKYLLESKPLILPPEHILKRGDSEAIAYAFFHLPHWKNVDGALNLLHCTWEGTFRMLPYPLEKGHLFYPY… |
| A0A0S7H9R3 | 156-367 | LPKSATICYTSALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAVAYAFFHL… |
| A0A3P8X2N5 | 316-521 | None |
| A0A2J7PWR8 | 61-273 | None |
| F1R8L6 | 222-434 | None |
| A0A817CYK4 | 708-920 | None |
| A0A5K4F057 | 97-313 | None |
| A0A0K0EM19 | 1714-1917 | None |
| A0A6J3ARL9 | 238-463 | None |
| A0A095B176 | 521-737 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.