DPCstruct | MC13024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 52 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 67.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2ASX0 | 19-65 | IPKNPKHPERICWGCERLCAANKMFCGNGSERSQHPCELFGEDWYLS |
| A0A2H5E1E1 | 6-55 | AKKFPLHPRHPERVCWGCDKYCPASDMACGNGSSRTQHPVEIFGEDWFEP |
| I4CW20 | 1-57 | None |
| A0A554X0A7 | 1-52 | None |
| A0A2R3Q5S5 | 1-53 | None |
| A0A6I1PS64 | 1-43 | None |
| A0A258N9E9 | 24-80 | None |
| A0A1J0ESN1 | 1-57 | None |
| A0A2M7Y1Y5 | 1-48 | None |
| A0A239LBK3 | 40-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.