DPCstruct | MC13019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 139 ± 21 aa |
| Standard deviation of domain lengths | 20.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8S8K3 | 2-107 | EPARLLRISNMARALLAEIRALPLDEHARERLRHAHARAVEEIGHAVGPELREELERLLPRTGGPFTEAEARILQSQLVGWLEGVFH… |
| A0A522QXA0 | 15-173 | TNETDAASEAEAITSQVERPDKVMRIGTMIKQLLEEVRAAPLDEAGRQRLREIHESSITELADGLAPDLREELSRLSLPFGSEVPSE… |
| A0A255HC40 | 11-154 | None |
| A0A7L7VT68 | 28-216 | None |
| A0A401YW16 | 4-140 | None |
| A0A1I5MJ63 | 9-159 | None |
| A0A7V5C0W2 | 22-151 | None |
| A0A2D8ALX8 | 28-161 | None |
| D9UH20 | 2-127 | None |
| A0A3S0DTP5 | 34-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.