DPCstruct | MC13018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7J5B2 | 459-555 | PETGRKHQLRVHLADGISTPILGDHKYSHRDKLAPQWLHKEILTKFNLKPMNARQMPLHLHARRLVLPNYFRNGQELTLTAKLPKFF… |
| A0A444V7L6 | 2-92 | SLGLGCQILGDHKYAHNSKLAPQKLSEGFLRRLGLVQSKARHLPLHLHARQLTFPGGAGGHQEVTVSSPLPKFFLTSLKRLKIELPG… |
| A0A7R8X1H1 | 444-572 | None |
| A0A131YZ36 | 150-269 | None |
| A0A5N5SWG7 | 102-219 | None |
| A0A813RXE9 | 203-311 | None |
| A0A158R4L4 | 355-450 | None |
| A0A0Q3PTI0 | 1-120 | None |
| A0A1S3KI22 | 778-879 | None |
| A0A226MLV2 | 535-634 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.