DPCstruct | MC13017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 128 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 45.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4F999 | 3-111 | GSPPTASLSSLMELENCVSNMSLAHEIVVNRDFCFKPRNPSTDSLEGRVTEIVHRAFWDSLQEQLNSDPPNYSHAVLLLQEVKTMLQ… |
| A0A2P4T8H0 | 19-156 | STASSSDSEYSRQSFNSDSSSKPSSPASASPPKMVTFDELMAAARNLSNLTLAHEIAVNANFCIKHEDHPQNSLAGTVKQIVHKAFW… |
| A0A444T1C8 | 103-249 | None |
| A0A131ZXM4 | 60-198 | None |
| B4DZS4 | 4-142 | None |
| A0A5F8A420 | 4-152 | None |
| A0A250Y0T8 | 2-89 | None |
| A0A668T924 | 1-98 | None |
| A0A1B0D176 | 11-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.