DPCstruct | MC13015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 344 ± 58 aa |
| Standard deviation of domain lengths | 57.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.52 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | PF05075- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0NXG8 | 1-268 | MAFLEQRTTNPLVMAMDAENIKTKATFQKWTTIYNRIFFNFLLLEAHATGLSIGTEENKEKLLVARQTVANSIATWREEYEKDEAYF… |
| A0A444V682 | 2-302 | ASKVKKQIEISGVYLKYSPIEENLRDAIRNVKEIQSYKPVKQSMIEEFLDEYPDALDIEDNLKNLYKGVMEKSILDIKKTSPRDIDE… |
| A0A238U4W7 | 4-397 | None |
| A0A4U5MKF8 | 68-426 | None |
| A0A4U5LPK3 | 135-568 | None |
| A0A2I4AJF5 | 5-241 | None |
| A0A6P8G338 | 33-378 | None |
| A0A6P8GI93 | 68-471 | None |
| A0A2P4UYH4 | 49-440 | None |
| A0A2P4UTE5 | 51-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.