DPCstruct | MC13012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 18.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4ATI8 | 84-208 | QCYGDFMKLNPTGAGKLTSGQDWLKYTGVRASNKMLDTDLAELNKRKQCYIRAGRNSCIHPAIIAAIASRESRGGRLLYASNGLGDK… |
| A0A444V3A4 | 2-126 | ACIYGDVTKIDTTGASEKTAKQDKLTVKGVAASHKLAEHDLANMNKYKPLIIKVGRAQQMDPCVIAGIISRESRAGTQLKDGWSTDK… |
| A0A671VPD6 | 96-217 | None |
| A0A672FSC1 | 1-123 | None |
| A0A017T1K6 | 436-554 | None |
| U5DP66 | 10-101 | None |
| A0A7X5TFV0 | 36-187 | None |
| A0A1Z3HR41 | 443-532 | None |
| A0A085WJ06 | 30-140 | None |
| A0A674IAJ4 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.