DPCstruct | MC13011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8SWV0 | 470-595 | SGGWAVIMCPCGIVYSIKCNFRAESPRDFTDILLSWKHMPNIVIYDFARGLATHMNLREPEKLPFTPFDGRLMAPTPDNITRAKEGK… |
| A0A3N0XPX5 | 159-284 | SGGWAVILCPCGVVYSVKFLIRAESPRDFSDMLFSWKHMPNICIYDFARGLATHANVRRPEAMPFAPFEGLLAEDTEDNLRAALSGT… |
| A0A0F8CYW1 | 230-348 | None |
| A0A484CSM2 | 132-261 | None |
| A0A7M5UYH7 | 452-584 | None |
| A0A0F8CGW5 | 110-237 | None |
| A0A7J6BT30 | 333-456 | None |
| A0A3N0YUW0 | 63-191 | None |
| A0A6P6P061 | 864-985 | None |
| A0A498LG83 | 24-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.