DPCstruct | MC13010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 157 ± 33 aa |
| Standard deviation of domain lengths | 32.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 61.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7FBS0 | 2-111 | LESNKGRTMLEFQELMTVFQLLHWNGSLKAMRERQCSRQEVVAHYSNRALDDDMRSQMALDWIAREQESAGSIRKELNQAERELESA… |
| A0A444UYF1 | 40-186 | YKEKREILSLALSQRHSEGASAQITQEFISHSVQEAASTASELMTVFQLLHWNGSLKIFRERKCSRKEVVSYYSQHRLDECFRSHMA… |
| A0A4W5M4J8 | 3-124 | None |
| A0A6B0SHN9 | 67-243 | None |
| A0A6J2DDQ9 | 172-281 | None |
| A0A3Q2PAS7 | 10-220 | None |
| A0A226P5W9 | 152-259 | None |
| A0A3Q3X6M2 | 77-249 | None |
| A0A6I8VWF9 | 25-162 | None |
| A0A6P8FS98 | 50-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.