DPCstruct | MC1301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 218 ± 24 aa |
| Standard deviation of domain lengths | 23.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF01915- PF20732- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1WH85 | 2-213 | PLDRLPELWPKSLKNVALGAVLHPASISASLTHASDVLKSHDGTLFRLKALFGPQHGYLGQTQDNMIEWGGFTHPLWNIPVYSLYGE… |
| A0A7W7PGQ7 | 31-245 | FGTDDAAGRTAPVRPGFDNLAADGYRVLEGQQVGVLTNMAGITRDCRSIVDVMHADDRVRVTAIFTGEHGYRGTPQAGKSEGDTIDR… |
| A0A2V5WTP7 | 3-235 | None |
| A0A6V8H7G8 | 669-912 | None |
| A0A136N795 | 21-216 | None |
| A0A816VWF4 | 2-199 | None |
| A0A2V7KLY1 | 12-243 | None |
| I0XB76 | 37-303 | None |
| A0A7V3M396 | 185-416 | None |
| A0A0G9L938 | 10-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.