DPCstruct | MC13009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 288 ± 22 aa |
| Standard deviation of domain lengths | 21.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.22 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0016- CL0672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8K0H9 | 80-307 | MKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWE… |
| S7MJX3 | 1-291 | MKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGYSGAAGGGGGWNDNTSLLWSGKSLLEGATGGQSCPQAMKKWGWE… |
| A0A1L8FAF1 | 545-841 | None |
| A0A811V7S8 | 563-857 | None |
| T1PHZ5 | 275-592 | None |
| F1QVU0 | 601-888 | None |
| A0A444TTU8 | 202-498 | None |
| A0A6P7S7X9 | 6-289 | None |
| H3B463 | 149-443 | None |
| Q7KJ08 | 888-1169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.