DPCstruct | MC13008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 343 ± 84 aa |
| Standard deviation of domain lengths | 83.70 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444UX56 | 56-395 | FLRVGGDPAWLQGLDSAPQRLRNLHEINKVLAHRPWLVAREHIEIGEQCWSMAELVQAVVLLAHCHALASFVFGVGIEQDPPVPGTP… |
| A0A255QYV9 | 414-840 | QLTLENENVFYDYWNQVRPSARSADDLTVELPSDEEAWRLLPEAISGAGQPLPNWAKAVATQLPRTAAAMLSLDAVHRLNSPIDATL… |
| A0A556TPD4 | 485-876 | None |
| A0A183NYW8 | 6-220 | None |
| A0A2P6NL48 | 165-495 | None |
| A0A1X2IKI8 | 627-917 | None |
| A0A182FGE2 | 85-467 | None |
| W4GDB0 | 134-464 | None |
| A0A158R0Q1 | 23-325 | None |
| U9UDK0 | 81-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.