DPCstruct | MC13007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 18.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9L002 | 1-122 | MVLPMELLLSLQRSHFILKGKNIQISQETGAGYNVISNGQISLEGQRFNLANCIQRKITLNSLKEHRSFQETILSKPMVFFTNVMVA… |
| A0A444UVA1 | 1-167 | MSFKGNRSQVSRTVSGIVSISSGELHTLTTCNCEIAVLPVELLFELQSPYFQKNDNTITVHNHEGGYSVFCDGKVEAGRETYTIRNY… |
| A0A836D289 | 1-164 | None |
| F6YZM4 | 4-135 | None |
| A0A6F9DGU2 | 1-131 | None |
| A0A7I8V6B9 | 22-135 | None |
| A0A5F5Y3R0 | 1-167 | None |
| S4RQ60 | 1-146 | None |
| A0A6P8R5E6 | 26-197 | None |
| C3Y3F1 | 4-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.