DPCstruct | MC13006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 65.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444UTT9 | 1-74 | MAQETNQTQVPTLCAMGCGFYGNPRTNGMCSVCYKEHLLRQQGRSSPPAASSPSSVVSGSGGCSVSGESTPVQC |
| A0A3M0K112 | 1-67 | MAQETNQTQVPLLCTTGCGFYGSPRTNGMCSVCYKEFLQRQQSSDRISPPGTLLEISQNTAESKTAS |
| A0A1B0C3F7 | 1-80 | None |
| A0A3Q0J6A3 | 1-69 | None |
| A0A803TKP9 | 18-100 | None |
| A0A7J8IV69 | 1-85 | None |
| A0A674NSY3 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.