DPCstruct | MC13003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 76 ± 13 aa |
| Standard deviation of domain lengths | 12.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3ECU9 | 23-93 | RFAADLDWVEKRGVRVRRYNLAQEPGAFVREPLVRHALQEQGEDALPLIVQGGRVLSHGRYPSREELGTWT |
| A0A847BDA8 | 1-63 | RYNLSSSPQEFVNNATVTTILQEELADALPITLVNGEVKKKGAYPTLDEISTFMGIQFVMAGS |
| T0QRL2 | 29-113 | None |
| D0TIM6 | 13-80 | None |
| A0A2A5S6Q2 | 10-76 | None |
| H5Y2J3 | 93-194 | None |
| A0A1F6PPG5 | 29-119 | None |
| A0A0B5K238 | 14-85 | None |
| A0A6N6P482 | 77-148 | None |
| A0A6I7P481 | 36-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.