DPCstruct | MC13000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 208 ± 38 aa |
| Standard deviation of domain lengths | 37.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9MIZ0 | 10-152 | PSAATDVTLVLRGHKPAARVSVGSRGGDLRRWARRYGLFTSIDADGFAAISRNPATARRVIDLDRRPGRHTLALGTMLGYPPCCSRA… |
| A0A661N6J2 | 22-218 | PSSPHIEYIAFRVGLKPALRLAPGRGLARERTRAEAQGLATRVRVGGSGRELLYIARDERRATALSEAEALSLCGTDASIEGHRELG… |
| A0A7X7WFN7 | 11-250 | None |
| A0A7C5W2A2 | 21-200 | None |
| A0A257LVU1 | 1-155 | None |
| A0A837IC62 | 7-194 | None |
| L1KYN1 | 636-895 | None |
| A0A1F9TG93 | 38-278 | None |
| A0A410P5B5 | 12-260 | None |
| A0A848A2I9 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.