DPCstruct | MC130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Standard deviation of domain lengths | 16.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H1BFX5 | 1-158 | MEPIREDMAPQVSGQLFWSPEDRPGRRGVLDRMKRRRRLQKSTTLNPEQLHDILSFIANNQDEGGTVLWTPEILFRYVPNRFEGATV… |
| A0A364L9I8 | 25-205 | SPENMNSKNASDLGANDAPALNLTGVINSQSAPPVGNGLGNQLRQPKPGRERNHQHLILSGKVGRQLTDQQLRDILQKSPNERDEFA… |
| A0A2B7WH35 | 2-119 | None |
| A0A178F8D5 | 23-183 | None |
| A0A2B7X9F5 | 42-198 | None |
| A0A2B7WH00 | 5-144 | None |
| E4V738 | 24-181 | None |
| C5FHG3 | 148-307 | None |
| A0A1J9QDQ2 | 1-142 | None |
| A0A2H3INM9 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.