DPCstruct | MC13
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U2K2P2 | 4-117 | DSQLVETLKKLDADLSAAAVVNARLSAELTILNDEVSKAEEFEKEKARYELVETSEGDFVFRIKSSMADEQPIHYICPVCLNQDKTI… |
| A0A2Z2LRW2 | 8-139 | GAVLGSLKTATEIAKFIRESDVSIERAELKLKVADLIGALADVKLELVELQDSFAAKDQRIKELEEAFEAKDSMVRKYDAYYNAGPD… |
| B5EI91 | 3-127 | None |
| A0A3B0M8H4 | 4-93 | None |
| A0A0Q8BPS9 | 3-125 | None |
| G2H702 | 2-120 | None |
| A0A411T4J4 | 6-154 | None |
| A0A126QNK4 | 2-122 | None |
| A0A0J1MFK0 | 65-212 | None |
| A6QAE0 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.