DPCstruct | MC12998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 222 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661N097 | 42-282 | AIHEPSETAEGDAPVAAEVITEEPQLLGPDAVAYNAELLDGLLERAMQETIREEKFGAAAGIMGGTTLLGLGAWRLIENDPGSQYSR… |
| A0A1F5BMY6 | 12-230 | DLSEEQVKERLGFLENALVSAQPRAKLWWYGWIAGYSAAALVQGGLAAVNWDKTGEDKDFAEDMLVGGATCALGAGGLLISPFVPAY… |
| A0A2M6X2K7 | 1-257 | None |
| A0A7X8V4N8 | 3-198 | None |
| A0A3N5J5M2 | 1-243 | None |
| A0A521TV99 | 62-265 | None |
| E0RNW9 | 144-378 | None |
| A0A3A8HEU3 | 396-624 | None |
| A0A4Q3K1U4 | 26-261 | None |
| A0A2N1R6J9 | 1-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.