DPCstruct | MC12997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 181 ± 14 aa |
| Standard deviation of domain lengths | 14.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3B9V9 | 3-174 | QSVCFDLRSRKQAVEISLGRGIQNMSPPPRLPDNIYGTDGVWELYSTPSRDARLKTAFKEMYDLVVEFIKMDMVDAPRLKYDGNNLP… |
| A0A661MXQ0 | 21-199 | DALEESVQRRRSSVQNGEDFMKARKYEPIDMPRGGALFLTSGPWEDYSTPSRDMRLLISIDAVVSFPATVAAHPGRFGIREADREEA… |
| A0A521TN94 | 373-562 | None |
| A0A1I1V821 | 781-973 | None |
| A0A1V5NHL9 | 309-491 | None |
| A0A2S9YV77 | 496-695 | None |
| A0A1F5A6P2 | 1-151 | None |
| A0A2M8B6P2 | 902-1080 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.