DPCstruct | MC12996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 174 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0R3G2 | 2-155 | PQDFNRQYRIALRRVRRVYPLVLEAARIIDSLDQELESIEKNRKKKKLMRKTHKALKDDFKYLLKDLYISEGKVLTKLIHRETGMTV… |
| A0A7X8I5D5 | 20-178 | MPVITLPTVVVYPTRTLGNDRASREYIALAQKVRKVYPYARLAVEVLAEINDTIAKMDLERARKRYIKEYEKALLAEYKTELVKMKV… |
| A0A1Q3ZLM6 | 5-189 | None |
| A0A2E5XC99 | 16-177 | None |
| A0A136MV24 | 15-190 | None |
| A0A2G2F0G9 | 17-188 | None |
| A0A1M3IH65 | 1-179 | None |
| A0A5Q5G1B7 | 1-134 | None |
| A0A507ZH63 | 2-167 | None |
| A0A401XKT6 | 31-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.