DPCstruct | MC12992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A747TWW7 | 27-151 | NPELMDTLLRSGQFQSMMVSQSFSGPLPPPDVIRGYDQILPGGAERIFSMAEKEQAHRHKMDSTAVNGAIRKDKRGQWMGFSIAITI… |
| A0A7X8FGV8 | 27-167 | ELKPILRKLSQEEQRKIKSIIVSSYQSYSGPIPAPEALEKYNQIIPDGADRIMRMAENQSNHRIKIEETVIAGQVKQSSRGQLFGLI… |
| A0A125P6M8 | 1-133 | None |
| A0A061QIB9 | 1-122 | None |
| A0A6B1E674 | 56-174 | None |
| J4V1F3 | 7-127 | None |
| A0A2D8Q9R6 | 4-112 | None |
| U2JB28 | 3-120 | None |
| A0A173LIX8 | 55-218 | None |
| A0A4Q7DJ28 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.