DPCstruct | MC12990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0AE82 | 104-163 | MAAVEKQLEEMGVRFVRRTVEEGGIFVDQIFFHDPDGFMIEICNCENFPVIPLLPAVNES |
| A0A4V4H677 | 1-70 | MGAMEQRLKDLGVKYLRRTINEEEGSPIDQLFFNDPDGFMIEICNCESLELVPAGSLGRLRLPWRSPRPP |
| A0A811R131 | 42-109 | None |
| A0A6I9RIC9 | 140-237 | None |
| A0A835APS0 | 222-294 | None |
| A0A0L9V3V5 | 1-74 | None |
| A0A6J5VL31 | 121-177 | None |
| A0A4S8IKX1 | 14-97 | None |
| A0A3L6R3N4 | 2-84 | None |
| A0A1D6MK37 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.