DPCstruct | MC1299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124I2W8 | 81-173 | MAERRARARAGQGPQPITTLLFHLAGCPNVGSFRFRSSSWRFAEGVQRIRTQLATVGDAALCELAIQTVEFPTQNGRRVCYHKPVVK… |
| A0A7W7LIU7 | 1-93 | MTERKAAAKSFQGPQPNTVLTFRLADAPELGLFRFHSMSWKLAEAIQEAKDAIDCANDGVLVELGLELVKLPTASGVSVSYRKPVIK… |
| A0A854VSD8 | 116-211 | None |
| A0A401MI65 | 75-165 | None |
| A0A7J0D481 | 3-106 | None |
| A0A540QH52 | 118-205 | None |
| A0A327TMZ6 | 47-133 | None |
| A0A3N6DN51 | 2-79 | None |
| A0A2V4NXM9 | 8-88 | None |
| A0A2P9FHH8 | 24-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.