DPCstruct | MC12989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 181 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 56.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4ETR5 | 87-278 | SESHRFAALELFTPLHGSFGSLEEASEALRTFEILGIGKELNIRDSTCPSVVDTLGSSSSSLKDLFYALRVNKLLKCETNEEVFAGI… |
| A0A835VKI3 | 3-178 | RRGILLLLCLLCATIVSCRASSVLRPVSEAHRSTALELFVPFDGSYGSLEDSYEALKTYQILGLDKIFDASLATCKSVIENLDSPSA… |
| A0A2J6JQ23 | 28-219 | None |
| A0A2R6QSE8 | 14-185 | None |
| A0A6A2YF73 | 1-181 | None |
| A0A6A6KD05 | 2-181 | None |
| A0A1S4CHX5 | 26-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.