DPCstruct | MC12986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 70.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9D4V5 | 77-144 | VDHRLEENAEERERVTASGGEVGRLNLFGGQEVGPLRCWPGGLCLSRSIGDMDVGEFIVPIPHVKQVK |
| A0A4S4DLT5 | 93-156 | AEERERVTASGGEVGRLNVFGGNEVGPLRCWPGGLCLSRSIGDTDVGEFIVPIPHVKQRSRGRR |
| A0A834ZFF3 | 165-234 | None |
| A0A7J7L417 | 1-69 | None |
| A0A803KUX2 | 173-235 | None |
| A0A388KPE2 | 7-81 | None |
| A0A5N6PNG1 | 386-448 | None |
| A9RD92 | 42-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.