DPCstruct | MC12985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 56.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5U1K1 | 7-122 | IGICVPTIGEEATRQFLDAWTPHWRQQACRFHVHVFLHEDRPRRSLDPGDRPFPLTHTAHEDISRVLGDREWIIPRGTGASRSFPMY… |
| A0A4S8K750 | 2-97 | PTIRNLDFLEMWRPFFQPYHLIIVQDGGDPSKTIRVPDGFDYELYNRNLGPKAAYISFNDAASRCFGYMISKKKYIFTIDDDYFVSA… |
| A0A804P9R6 | 7-116 | None |
| A0A6J8D9G8 | 1-122 | None |
| A0A817H9T1 | 46-152 | None |
| A0A1R3IBE6 | 1-110 | None |
| A0A7J6FHV0 | 89-191 | None |
| A0A5N5ICP2 | 22-122 | None |
| A0A4Y1QR61 | 61-172 | None |
| A0A6A2YEV5 | 134-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.