DPCstruct | MC12983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 67.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0E3N4 | 13-96 | FYVKVDDDVHVNIATLGQILSNHALKPRVYIGCMKSGPVLTEKGVRYYEPEHWKFGEPGNKYFRHATGQLYAISKDLATYISIN |
| A0A4S8K230 | 1-71 | MLIANLARHRTTPRVYIGCMKSDQVLFQRDAKYHEPEFWKFGEEGNKYFRHATGQIYAISKDLALYISINA |
| A0A1R3HRB1 | 236-311 | None |
| A0A811NW58 | 931-1002 | None |
| A0A5C7IPV2 | 63-134 | None |
| A0A453S720 | 165-241 | None |
| A0A6A6LQL9 | 94-166 | None |
| A0A816R2S8 | 474-544 | None |
| A0A452XFZ1 | 57-141 | None |
| A0A2G2X598 | 102-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.