DPCstruct | MC12980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.32 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0267- PF00410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4AVS8 | 1-41 | MGPQHLVGETVFGVAHIFASFNDTFVHVTDLSGRETIARVT |
| A0A4S8JWY8 | 38-92 | RRKTREPKEYNVLLGPAVREGEQVFGVAHIFASFNDTCIHVTDLSGRETLVRITG |
| A0A0D2ZT05 | 52-113 | None |
| A0A426XX98 | 186-245 | None |
| A0A4U0W250 | 1-58 | None |
| A0A1U8PPB3 | 80-139 | None |
| A0A4S8IE71 | 74-133 | None |
| A0A226NSV9 | 2-69 | None |
| A0A816PCU3 | 336-392 | None |
| A0A6A3CLD1 | 416-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.