DPCstruct | MC1298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 74.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9GEH2 | 1-70 | MIHTVLRRRAAGEPIGKIRKDLIIPTGKRKGHNPSLASIYRALAEHEKAQRHPDAVEQARAEYAALHQEL |
| A0A7W7LIN9 | 1-84 | MLHTVLRRRAGGESVEQIQSDLIIPTGKRKGQNPSVASIYRALAEHAKREAYPEAITAAHADFAAMNNGAVPEPHSQAEALKSR |
| A0A561VMC2 | 1-70 | None |
| A0A7W8BMY0 | 120-192 | None |
| A0A1I4AES2 | 97-186 | None |
| A0A438M641 | 46-113 | None |
| A0A6B3HYR8 | 172-247 | None |
| A0A3N6HEV7 | 35-109 | None |
| A0A2N3TFM6 | 135-208 | None |
| A0A1H4I7X6 | 204-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.