DPCstruct | MC12979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6MFH0 | 110-188 | MPIGNYTLHLDEGMAIKVCLYDESDRIPVHTEEKIFYTEDDYRDFLARRAWTCLRDLDGYRNIDNMDDLRPGAIYRGVS |
| A0A4S8JWV5 | 1-82 | MPLGSYTLHLDEGISIKVCIYDDTDRIAVHTEEKTLYTEDDFRDFLSHRGWAGLRELSSFRNVVTLDDLRPGAMYQGMKLLS |
| A0A438G2I2 | 118-188 | None |
| A0A803L125 | 282-365 | None |
| A0A803QL89 | 864-955 | None |
| A0A0E0H2B9 | 770-849 | None |
| A0A835HL16 | 690-760 | None |
| A0A822ZDI1 | 34-135 | None |
| A0A178WNF7 | 71-148 | None |
| A0A176WHM3 | 271-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.