DPCstruct | MC12978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4Q4W9 | 1-123 | MVKLASARDFRTYGTGLTRNRCEYINAGLYLFATIVFCCAFASQFSSEPRSGLVLFLISFAIILIVNVHDLFAHLSGIDFRLPLMAF… |
| A0A4S8JV87 | 1-134 | MVKLASARESRTYGPGSRLARTRWEYINAGLYLFATALLVGGFAAQISSVSSAGAKSGLVAVLVALALLLAVNAHDLVAHLAAVDYC… |
| A0A453A286 | 1-128 | None |
| A0A453A231 | 84-206 | None |
| A0A2K1KWW1 | 1-124 | None |
| B6SJE1 | 1-144 | None |
| A0A6G1EQ60 | 1-117 | None |
| A0A444CGG5 | 1-122 | None |
| A0A6N2KJB3 | 115-239 | None |
| A0A445L4G6 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.