DPCstruct | MC12975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9W5E6 | 2-140 | LTGRVADPSLFTAPLIHEFGWDMGDWNRLGQATVVGHLLECAGQVTGGYFADPGFKDVPNLARLGFPIGEVDADGSVVVTKVPHAGG… |
| A0A2V7LB16 | 530-677 | GAWPVVDALRGGADVVVTGRVTDTGLTLAPMIHAFGWQPDAWDLLAAGTVAGHTIECGAQSSGGNCLVDWERIPDLANVGYPIVDAA… |
| A0A100J341 | 130-273 | None |
| A0A257V301 | 5-150 | None |
| R1G5J4 | 7-118 | None |
| A0A287X0S6 | 141-286 | None |
| A0A7I4EMV2 | 162-314 | None |
| A0A0G4L536 | 191-337 | None |
| A0A0G4L9A6 | 178-335 | None |
| A0A0G4KQJ7 | 6-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.