DPCstruct | MC12974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 308 |
|---|---|
| Mean domain length (aa) | 135 ± 39 aa |
| Standard deviation of domain lengths | 38.53 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.38 |
| Pfam Score | 52.71 |
| Assigned Pfam label(s) | PF07930- CL0013- PF11954- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9W398 | 29-135 | AERLANLHFGRHEPRASVPIDPPLLETYTGCYRLGPKYFVRVTTEAGALNIHARGQEPLRLAYAGADSFFCQVRDMQIDFQRADEGS… |
| A0A838KS61 | 2-75 | AGDWYWGNVAMTAAATTDGFTLTTEGAARAFVEVGTDTYRGGNGYFAGEELRVVRRPDSSVSHLEVVTFIFTRT |
| B9XG07 | 399-504 | None |
| G3JFC5 | 884-1104 | None |
| H8GUR1 | 192-340 | None |
| A0A6L7JTP1 | 130-227 | None |
| A0A7V2ZHR9 | 1-86 | None |
| A0A523E6Y8 | 108-240 | None |
| A0A2E0UT53 | 285-405 | None |
| A0A2V7W6I0 | 91-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.