DPCstruct | MC1297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 73 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3DJE7 | 105-173 | AFARIPQDRLRFTSLVVASTDDPYGSCDYAEARAARWGSGIAVIGSAGHINAQSGMGDWPQGRALLDGL |
| A0A7U8JNI9 | 105-176 | KALHPLPRHELGFPSIVVASRNDEYMSFAKAEALSHVWGSGFVDLGHAGHINVASGFGHWPDGAILASSLHR |
| A0A7Y0JLW5 | 202-269 | None |
| L9LXE5 | 1-54 | None |
| A0A4R3N6Y2 | 2-54 | None |
| A0A223P2U9 | 3-63 | None |
| A0A6J6BWA4 | 18-140 | None |
| A0A839LCV8 | 19-94 | None |
| A0A3S5K191 | 350-430 | None |
| A0A1J5QMB9 | 88-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.