DPCstruct | MC12969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 63.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 37.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3LMH9 | 8-113 | FLLASFVSFMSCSDGNTNKEGNTPGTAPSTMAAPTNTAALNPPHGQPGHRCDIEVGAPLNTPAAPNLPMPNLNPLPAQGTVVPGTNP… |
| A0A4Q3ES92 | 18-143 | IGCQSQAGEEEYVPTPAVNAAPVTTTDSGTTALPALPPVLPQVPLTNTAGRPAVNPAHGLPFHDCALEVGAPFPTSGQQPAFGAPAQ… |
| A0A3N7ACC7 | 49-177 | None |
| A0A4V6WMY7 | 11-122 | None |
| A0A2N2ZVE4 | 20-133 | None |
| A0A0P0D2A2 | 3-108 | None |
| A0A4V2TPS0 | 11-124 | None |
| A0A177LMI3 | 12-129 | None |
| A0A2N3AAQ8 | 40-161 | None |
| A0A4S3M0J2 | 21-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.