DPCstruct | MC12966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645E068 | 211-315 | GYNGLYLVAKVEGGLSLDWLKLAINGLSDISTTPLSGAMINDAQNIIKKRWPSVKMTVYEYIPFVGLSKIINPSGKVTEYLYNASGK… |
| A0A4Q3DYA5 | 1-104 | MPIAKIENIAYASIPSTALSDAVTASNTQTESQLLIKLEALRNNPALTYAMMSSYTFIPGIGVSKMVQPNGNTVTYTYDSLGRLITA… |
| A0A3G6MLL9 | 7-124 | None |
| A0A502DYV2 | 255-370 | None |
| A0A2N0XE54 | 986-1096 | None |
| A0A645B850 | 482-589 | None |
| A0A3D9AGT9 | 695-815 | None |
| A0A7Y0FTL1 | 497-614 | None |
| A0A1G9JXT2 | 1066-1176 | None |
| A0A349R096 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.