DPCstruct | MC12965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 24.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9A380 | 24-180 | LLDEKHHHFMANTLILVTFDENHTYTSSNRVLGMLLGDAVPKKLIGTTDPQYYNHYSEISTVEANWNLHTLGRWDVGANIFSVVADQ… |
| A0A0D1WSI0 | 401-591 | SDGHDTSVTVAGAWTRNFLEPLLKDSRFMKNTMVLVHFDENHTYTIQNRVLGILLGDAVPTSLAGTTDSNFYDHYSEISTVEANWDL… |
| A0A2S4PV59 | 114-256 | None |
| A0A261XSS2 | 1-147 | None |
| A0A0E9NIR5 | 321-503 | None |
| A0A1C7MH11 | 707-948 | None |
| A0A0V1PWM7 | 1-152 | None |
| A0A094IVY1 | 214-394 | None |
| A0A0L1JG17 | 213-394 | None |
| A0A5C3ENC2 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.