DPCstruct | MC12961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 3.78 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9QL08 | 9-77 | SGNPFTTTVGQKIEQATDPSLASENWALNMEICDHINDTDEGPRDAVRAIRKRLQQNSGKNFTVIMFTL |
| A0A672H070 | 3-75 | FLMGNPFSTPVGQLIERATSASLPSDDWELNMEICDMVNSSEEGPRDAVRAIKKRIVGNKNFKEVMLTLTVLE |
| A0A2U9BQP0 | 2-82 | None |
| A0A6P4YFE5 | 2-75 | None |
| A0A6J1VU95 | 7-73 | None |
| A0A6A4SKJ2 | 246-319 | None |
| A0A212D9N8 | 1-77 | None |
| A0A5A9NYS5 | 1-75 | None |
| M7B540 | 1-77 | None |
| A0A6A4SWV3 | 4-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.