DPCstruct | MC12960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183GA91 | 76-168 | GLKDCFLTEGKPEELCYLACIKDGKCTSSVNLAEFAANRTVYVQSGRKGKSGLVLHPGSPCNNYKGYCDIFRKCRSVDANGPLARLK… |
| A0A7R9QL04 | 5-83 | LESCQCRRGPNDPITKSCELCCRLPSKDSTCKSSFEWNSVPYDVPDLNAKAGTPCDNYNGYCDAFQKCREVDPSGPLAT |
| H2Y605 | 277-360 | None |
| A0A3Q0JGH7 | 639-728 | None |
| A0A6P8G5Q3 | 126-211 | None |
| A0A7J6Z779 | 939-1013 | None |
| A0A3Q0KUN7 | 241-343 | None |
| A0A5B7DKL8 | 460-545 | None |
| A0A6J8CHW0 | 690-778 | None |
| A0A0N4VUI1 | 192-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.